Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 300376..300570 | Replicon | chromosome |
| Accession | NZ_CP097038 | ||
| Organism | Enterococcus faecalis strain AT39 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | M2911_RS01505 | Protein ID | WP_162781186.1 |
| Coordinates | 300475..300570 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 300376..300440 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2911_RS01490 | 295994..297736 | + | 1743 | WP_002397018.1 | PTS transporter subunit EIIC | - |
| M2911_RS01495 | 297727..299760 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
| M2911_RS01500 | 299771..300205 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - | 300376..300440 | + | 65 | - | - | Antitoxin |
| M2911_RS01505 | 300475..300570 | - | 96 | WP_162781186.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| M2911_RS01510 | 300816..302588 | + | 1773 | WP_113847474.1 | PTS mannitol-specific transporter subunit IIBC | - |
| M2911_RS01515 | 302603..303040 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| M2911_RS01520 | 303055..304209 | + | 1155 | WP_002395429.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| M2911_RS01525 | 304276..305391 | - | 1116 | WP_033785759.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3658.53 Da Isoelectric Point: 8.6635
>T244524 WP_162781186.1 NZ_CP097038:c300570-300475 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244524 NZ_CP097038:300376-300440 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|