Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2680536..2680872 | Replicon | chromosome |
Accession | NZ_CP097034 | ||
Organism | Enterococcus faecalis strain AT40b |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | M2913_RS13030 | Protein ID | WP_002396786.1 |
Coordinates | 2680536..2680679 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2680823..2680872 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2913_RS13010 | 2675752..2675967 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2913_RS13015 | 2676106..2677098 | + | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2913_RS13020 | 2677265..2677903 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
M2913_RS13025 | 2678588..2680204 | + | 1617 | WP_002378864.1 | phosphatase PAP2/LCP family protein | - |
M2913_RS13030 | 2680536..2680679 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- | 2680823..2680872 | + | 50 | - | - | Antitoxin |
M2913_RS13035 | 2680874..2685565 | - | 4692 | WP_002378865.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T244520 WP_002396786.1 NZ_CP097034:2680536-2680679 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244520 NZ_CP097034:2680823-2680872 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|