Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2660733..2661066 | Replicon | chromosome |
| Accession | NZ_CP097031 | ||
| Organism | Enterococcus faecalis strain AT41 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q82Z30 |
| Locus tag | M2914_RS12765 | Protein ID | WP_002387585.1 |
| Coordinates | 2660733..2660876 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2661017..2661066 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (2655757) | 2655757..2655933 | - | 177 | NuclAT_14 | - | - |
| - (2655791) | 2655791..2655945 | - | 155 | NuclAT_7 | - | - |
| M2914_RS12755 (2656085) | 2656085..2656189 | + | 105 | WP_021164545.1 | putative holin-like toxin | - |
| - (2656122) | 2656122..2656377 | - | 256 | NuclAT_0 | - | - |
| M2914_RS12760 (2656379) | 2656379..2660137 | - | 3759 | WP_116495142.1 | WxL domain-containing protein | - |
| - (2660478) | 2660478..2660622 | - | 145 | NuclAT_5 | - | - |
| - (2660480) | 2660480..2660622 | - | 143 | NuclAT_15 | - | - |
| M2914_RS12765 (2660733) | 2660733..2660876 | + | 144 | WP_002387585.1 | putative holin-like toxin | Toxin |
| - (2660851) | 2660851..2661065 | - | 215 | NuclAT_2 | - | - |
| - (2661017) | 2661017..2661066 | + | 50 | NuclAT_18 | - | Antitoxin |
| - (2660808) | 2660808..2661067 | - | 260 | NuclAT_13 | - | - |
| M2914_RS12770 (2661067) | 2661067..2664111 | - | 3045 | WP_161970605.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5244.37 Da Isoelectric Point: 10.5719
>T244505 WP_002387585.1 NZ_CP097031:2660733-2660876 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILKVVKEDKKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILKVVKEDKKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244505 NZ_CP097031:2661017-2661066 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|