Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2655791..2656189 | Replicon | chromosome |
Accession | NZ_CP097031 | ||
Organism | Enterococcus faecalis strain AT41 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | M2914_RS12755 | Protein ID | WP_021164545.1 |
Coordinates | 2656085..2656189 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2655791..2655945 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2914_RS12735 (2650934) | 2650934..2651149 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2914_RS12740 (2651288) | 2651288..2652280 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2914_RS12745 (2652544) | 2652544..2653182 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
M2914_RS12750 (2653867) | 2653867..2655483 | + | 1617 | WP_010778027.1 | phosphatase PAP2/LCP family protein | - |
- (2655757) | 2655757..2655933 | - | 177 | NuclAT_14 | - | - |
- (2655791) | 2655791..2655945 | - | 155 | NuclAT_7 | - | Antitoxin |
M2914_RS12755 (2656085) | 2656085..2656189 | + | 105 | WP_021164545.1 | putative holin-like toxin | Toxin |
- (2656122) | 2656122..2656377 | - | 256 | NuclAT_0 | - | - |
M2914_RS12760 (2656379) | 2656379..2660137 | - | 3759 | WP_116495142.1 | WxL domain-containing protein | - |
- (2660478) | 2660478..2660622 | - | 145 | NuclAT_5 | - | - |
- (2660480) | 2660480..2660622 | - | 143 | NuclAT_15 | - | - |
M2914_RS12765 (2660733) | 2660733..2660876 | + | 144 | WP_002387585.1 | putative holin-like toxin | - |
- (2660851) | 2660851..2661065 | - | 215 | NuclAT_2 | - | - |
- (2661017) | 2661017..2661066 | + | 50 | NuclAT_18 | - | - |
- (2660808) | 2660808..2661067 | - | 260 | NuclAT_13 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3813.70 Da Isoelectric Point: 10.3686
>T244496 WP_021164545.1 NZ_CP097031:2656085-2656189 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 105 bp
Antitoxin
Download Length: 155 bp
>AT244496 NZ_CP097031:c2655945-2655791 [Enterococcus faecalis]
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGTGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGTGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|