Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2583025..2583483 | Replicon | chromosome |
Accession | NZ_CP097031 | ||
Organism | Enterococcus faecalis strain AT41 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | M2914_RS12425 | Protein ID | WP_002392696.1 |
Coordinates | 2583340..2583483 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2583025..2583165 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2914_RS12410 (2578587) | 2578587..2579300 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
M2914_RS12415 (2579561) | 2579561..2582305 | + | 2745 | WP_116495149.1 | glycosyl hydrolase family 65 protein | - |
M2914_RS12420 (2582320) | 2582320..2582970 | + | 651 | WP_002415627.1 | beta-phosphoglucomutase | - |
- (2583025) | 2583025..2583165 | + | 141 | NuclAT_6 | - | Antitoxin |
- (2583221) | 2583221..2583362 | + | 142 | NuclAT_16 | - | - |
- (2583221) | 2583221..2583407 | + | 187 | NuclAT_1 | - | - |
M2914_RS12425 (2583340) | 2583340..2583483 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2583596) | 2583596..2583730 | + | 135 | NuclAT_17 | - | - |
- (2583584) | 2583584..2583733 | + | 150 | NuclAT_3 | - | - |
M2914_RS12430 (2584006) | 2584006..2584599 | + | 594 | WP_161970597.1 | PBECR4 domain-containing protein | - |
- (2584722) | 2584722..2584862 | + | 141 | NuclAT_4 | - | - |
M2914_RS12435 (2585361) | 2585361..2585894 | + | 534 | WP_002416003.1 | CPBP family intramembrane metalloprotease | - |
M2914_RS12440 (2585948) | 2585948..2586919 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
M2914_RS12445 (2587094) | 2587094..2587531 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
M2914_RS12450 (2587664) | 2587664..2588218 | - | 555 | WP_002378827.1 | nucleoside triphosphate pyrophosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244490 WP_002392696.1 NZ_CP097031:c2583483-2583340 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 141 bp
>AT244490 NZ_CP097031:2583025-2583165 [Enterococcus faecalis]
TGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACGTACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTTGA
ATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAA
TGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACGTACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTTGA
ATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|