Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 303622..303817 | Replicon | chromosome |
Accession | NZ_CP097031 | ||
Organism | Enterococcus faecalis strain AT41 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | M2914_RS01530 | Protein ID | WP_015543884.1 |
Coordinates | 303722..303817 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 303622..303687 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2914_RS01515 (299248) | 299248..300996 | + | 1749 | WP_161970589.1 | PTS transporter subunit EIIC | - |
M2914_RS01520 (300987) | 300987..303020 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
M2914_RS01525 (303031) | 303031..303465 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (303622) | 303622..303687 | + | 66 | NuclAT_21 | - | Antitoxin |
M2914_RS01530 (303722) | 303722..303817 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M2914_RS01535 (304063) | 304063..305835 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
M2914_RS01540 (305850) | 305850..306287 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
M2914_RS01545 (306302) | 306302..307456 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
M2914_RS01550 (307525) | 307525..308640 | - | 1116 | WP_116495098.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244481 WP_015543884.1 NZ_CP097031:c303817-303722 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT244481 NZ_CP097031:303622-303687 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|