Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2681978..2682314 | Replicon | chromosome |
| Accession | NZ_CP097030 | ||
| Organism | Enterococcus faecalis strain AT43a | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | M2915_RS12730 | Protein ID | WP_002396786.1 |
| Coordinates | 2681978..2682121 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2682265..2682314 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2915_RS12705 (2677255) | 2677255..2678550 | - | 1296 | WP_002396787.1 | ATP-binding protein | - |
| M2915_RS12710 (2679012) | 2679012..2680628 | + | 1617 | WP_002358967.1 | phosphatase PAP2/LCP family protein | - |
| M2915_RS12715 (2680983) | 2680983..2681105 | + | 123 | WP_002404776.1 | putative holin-like toxin | - |
| - (2681171) | 2681171..2681234 | - | 64 | NuclAT_10 | - | - |
| - (2681038) | 2681038..2681245 | - | 208 | NuclAT_7 | - | - |
| M2915_RS12720 (2681291) | 2681291..2681488 | + | 198 | WP_002358966.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - (2681421) | 2681421..2681605 | - | 185 | NuclAT_6 | - | - |
| - (2681462) | 2681462..2681605 | - | 144 | NuclAT_9 | - | - |
| M2915_RS12725 (2681607) | 2681607..2681747 | + | 141 | WP_077143780.1 | putative holin-like toxin | - |
| - (2681680) | 2681680..2681881 | - | 202 | NuclAT_4 | - | - |
| M2915_RS12730 (2681978) | 2681978..2682121 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| - (2682265) | 2682265..2682314 | + | 50 | NuclAT_11 | - | Antitoxin |
| - (2682053) | 2682053..2682315 | - | 263 | NuclAT_8 | - | - |
| M2915_RS12735 (2682316) | 2682316..2687007 | - | 4692 | WP_085366674.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T244480 WP_002396786.1 NZ_CP097030:2681978-2682121 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
>T244480 NZ_CP097030:2681978-2682121 [Enterococcus faecalis]
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
Antitoxin
Download Length: 50 bp
>AT244480 NZ_CP097030:2682265-2682314 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|