Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 119622..120157 Replicon plasmid pAT45b-a
Accession NZ_CP097023
Organism Enterococcus faecium strain AT45b

Toxin (Protein)


Gene name yoeB Uniprot ID Q3Y221
Locus tag M2917_RS13860 Protein ID WP_002305108.1
Coordinates 119622..119894 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A133CED7
Locus tag M2917_RS13865 Protein ID WP_002303154.1
Coordinates 119894..120157 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2917_RS13820 (M2917_13820) 114946..115275 - 330 Protein_131 recombinase family protein -
M2917_RS13825 (M2917_13825) 115351..116031 + 681 WP_053109539.1 IS6-like element IS1216 family transposase -
M2917_RS13830 (M2917_13830) 116065..116238 - 174 WP_229214455.1 hypothetical protein -
M2917_RS13835 (M2917_13835) 116250..116987 - 738 WP_002331331.1 S8 family serine peptidase -
M2917_RS13840 (M2917_13840) 117247..117795 - 549 WP_002292681.1 hypothetical protein -
M2917_RS13845 (M2917_13845) 117796..118653 - 858 WP_002292680.1 ParA family protein -
M2917_RS13850 (M2917_13850) 118939..119226 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
M2917_RS13855 (M2917_13855) 119216..119545 - 330 WP_002292678.1 AbrB family transcriptional regulator -
M2917_RS13860 (M2917_13860) 119622..119894 - 273 WP_002305108.1 Txe/YoeB family addiction module toxin Toxin
M2917_RS13865 (M2917_13865) 119894..120157 - 264 WP_002303154.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M2917_RS13870 (M2917_13870) 120263..120586 - 324 WP_229214454.1 hypothetical protein -
M2917_RS13875 (M2917_13875) 120685..121248 - 564 Protein_142 IS6-like element ISS1N family transposase -
M2917_RS13880 (M2917_13880) 121328..122490 + 1163 WP_086956687.1 IS3 family transposase -
M2917_RS13885 (M2917_13885) 122634..123071 - 438 WP_002307485.1 universal stress protein -
M2917_RS13890 (M2917_13890) 123080..124687 - 1608 WP_010724683.1 Nramp family divalent metal transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ClpL - 1..142475 142475
- inside IScluster/Tn - - 115351..139124 23773


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10806.28 Da        Isoelectric Point: 9.9080

>T244451 WP_002305108.1 NZ_CP097023:c119894-119622 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTYEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9886.16 Da        Isoelectric Point: 4.5370

>AT244451 WP_002303154.1 NZ_CP097023:c120157-119894 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDLKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A133CER3

Antitoxin

Source ID Structure
AlphaFold DB A0A133CED7

References