Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2571118..2571560 | Replicon | chromosome |
| Accession | NZ_CP097020 | ||
| Organism | Enterococcus faecalis strain AT46a | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | M2918_RS12215 | Protein ID | WP_002392696.1 |
| Coordinates | 2571118..2571261 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2571362..2571560 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2918_RS12200 (2566367) | 2566367..2567080 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| M2918_RS12205 (2567341) | 2567341..2570085 | + | 2745 | WP_174113967.1 | glycoside hydrolase family 65 protein | - |
| M2918_RS12210 (2570100) | 2570100..2570750 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - (2570819) | 2570819..2570952 | + | 134 | NuclAT_15 | - | - |
| - (2570999) | 2570999..2571144 | + | 146 | NuclAT_13 | - | - |
| - (2570999) | 2570999..2571185 | + | 187 | NuclAT_10 | - | - |
| M2918_RS12215 (2571118) | 2571118..2571261 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2571374) | 2571374..2571519 | + | 146 | NuclAT_14 | - | - |
| - (2571362) | 2571362..2571560 | + | 199 | NuclAT_9 | - | Antitoxin |
| M2918_RS12220 (2571493) | 2571493..2571636 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
| M2918_RS13500 (2572044) | 2572044..2572169 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| M2918_RS12225 (2572374) | 2572374..2572580 | + | 207 | WP_258075960.1 | CPBP family intramembrane metalloprotease | - |
| M2918_RS12230 (2572633) | 2572633..2573604 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| M2918_RS12235 (2573779) | 2573779..2574216 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| M2918_RS12240 (2574349) | 2574349..2574903 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244433 WP_002392696.1 NZ_CP097020:c2571261-2571118 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 199 bp
>AT244433 NZ_CP097020:2571362-2571560 [Enterococcus faecalis]
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|