Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 912258..912594 | Replicon | chromosome |
| Accession | NZ_CP097010 | ||
| Organism | Enterococcus faecalis strain AT48 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | M2921_RS04235 | Protein ID | WP_002396786.1 |
| Coordinates | 912258..912401 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 912545..912594 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2921_RS04225 | 907590..907694 | + | 105 | WP_021164545.1 | putative holin-like toxin | - |
| M2921_RS04230 | 907884..911663 | - | 3780 | WP_010818049.1 | WxL domain-containing protein | - |
| M2921_RS04235 | 912258..912401 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| - | 912545..912594 | + | 50 | - | - | Antitoxin |
| M2921_RS04240 | 912595..915654 | - | 3060 | WP_002398514.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T244410 WP_002396786.1 NZ_CP097010:912258-912401 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244410 NZ_CP097010:912545-912594 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|