Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 829069..829331 | Replicon | chromosome |
Accession | NZ_CP097010 | ||
Organism | Enterococcus faecalis strain AT48 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | M2921_RS03885 | Protein ID | WP_002392696.1 |
Coordinates | 829188..829331 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 829069..829214 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2921_RS03870 | 824484..827228 | + | 2745 | WP_025189669.1 | glycosyl hydrolase family 65 protein | - |
M2921_RS03875 | 827243..827893 | + | 651 | WP_002398182.1 | beta-phosphoglucomutase | - |
M2921_RS03880 | 828355..828948 | + | 594 | WP_002398183.1 | PBECR4 domain-containing protein | - |
- | 829069..829214 | + | 146 | - | - | Antitoxin |
M2921_RS03885 | 829188..829331 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
M2921_RS03890 | 829563..830534 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
M2921_RS03895 | 830709..831146 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
M2921_RS03900 | 831279..831833 | - | 555 | WP_002354869.1 | Maf family protein | - |
M2921_RS03905 | 831858..833990 | - | 2133 | WP_010716772.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244399 WP_002392696.1 NZ_CP097010:c829331-829188 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT244399 NZ_CP097010:829069-829214 [Enterococcus faecalis]
TGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|