Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2622030..2622366 | Replicon | chromosome |
| Accession | NZ_CP097008 | ||
| Organism | Enterococcus faecalis strain AT50 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | M2923_RS12335 | Protein ID | WP_002396786.1 |
| Coordinates | 2622030..2622173 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2622317..2622366 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2923_RS12320 (2617746) | 2617746..2618378 | - | 633 | WP_002358972.1 | RloB family protein | - |
| M2923_RS12325 (2618387) | 2618387..2619682 | - | 1296 | WP_002410675.1 | ATP-binding protein | - |
| M2923_RS12330 (2620144) | 2620144..2621760 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| M2923_RS12335 (2622030) | 2622030..2622173 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| - (2622317) | 2622317..2622366 | + | 50 | NuclAT_8 | - | Antitoxin |
| - (2622105) | 2622105..2622367 | - | 263 | NuclAT_7 | - | - |
| M2923_RS12340 (2622368) | 2622368..2627059 | - | 4692 | WP_248857869.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T244392 WP_002396786.1 NZ_CP097008:2622030-2622173 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244392 NZ_CP097008:2622317-2622366 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|