Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 306741..306935 | Replicon | chromosome |
Accession | NZ_CP097008 | ||
Organism | Enterococcus faecalis strain AT50 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | M2923_RS01540 | Protein ID | WP_015543884.1 |
Coordinates | 306840..306935 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 306741..306805 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2923_RS01525 (302374) | 302374..304116 | + | 1743 | WP_162780888.1 | PTS transporter subunit EIIC | - |
M2923_RS01530 (304107) | 304107..306140 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
M2923_RS01535 (306151) | 306151..306585 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (306741) | 306741..306805 | + | 65 | NuclAT_9 | - | Antitoxin |
M2923_RS01540 (306840) | 306840..306935 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M2923_RS01545 (307181) | 307181..308953 | + | 1773 | WP_002389635.1 | PTS mannitol-specific transporter subunit IIBC | - |
M2923_RS01550 (308968) | 308968..309405 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
M2923_RS01555 (309420) | 309420..310574 | + | 1155 | WP_010709200.1 | mannitol-1-phosphate 5-dehydrogenase | - |
M2923_RS01560 (310643) | 310643..311758 | - | 1116 | WP_010709201.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244378 WP_015543884.1 NZ_CP097008:c306935-306840 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244378 NZ_CP097008:306741-306805 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|