Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2622089..2622424 | Replicon | chromosome |
| Accession | NZ_CP097006 | ||
| Organism | Enterococcus faecalis strain LS05-1 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | M2924_RS12270 | Protein ID | WP_002415596.1 |
| Coordinates | 2622089..2622232 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2622374..2622424 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2924_RS12250 (2617157) | 2617157..2617372 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| M2924_RS12255 (2617511) | 2617511..2618503 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| M2924_RS12260 (2618807) | 2618807..2619445 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
| M2924_RS12265 (2620132) | 2620132..2621748 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| M2924_RS12270 (2622089) | 2622089..2622232 | + | 144 | WP_002415596.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2622165) | 2622165..2622423 | - | 259 | NuclAT_3 | - | - |
| - (2622374) | 2622374..2622424 | + | 51 | NuclAT_13 | - | Antitoxin |
| M2924_RS12275 (2622425) | 2622425..2626192 | - | 3768 | WP_104807327.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5314.46 Da Isoelectric Point: 10.6323
>T244376 WP_002415596.1 NZ_CP097006:2622089-2622232 [Enterococcus faecalis]
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 51 bp
>AT244376 NZ_CP097006:2622374-2622424 [Enterococcus faecalis]
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|