Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2543089..2543492 | Replicon | chromosome |
| Accession | NZ_CP097006 | ||
| Organism | Enterococcus faecalis strain LS05-1 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | M2924_RS11920 | Protein ID | WP_023894767.1 |
| Coordinates | 2543388..2543492 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2543089..2543221 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2924_RS11905 (2538637) | 2538637..2539350 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
| M2924_RS11910 (2539611) | 2539611..2542355 | + | 2745 | WP_104807179.1 | glycosyl hydrolase family 65 protein | - |
| M2924_RS11915 (2542370) | 2542370..2543020 | + | 651 | WP_002375514.1 | beta-phosphoglucomutase | - |
| - (2543089) | 2543089..2543221 | + | 133 | NuclAT_12 | - | Antitoxin |
| - (2543268) | 2543268..2543455 | + | 188 | NuclAT_4 | - | - |
| M2924_RS11920 (2543388) | 2543388..2543492 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
| - (2543644) | 2543644..2543789 | + | 146 | NuclAT_11 | - | - |
| - (2543644) | 2543644..2543830 | + | 187 | NuclAT_5 | - | - |
| M2924_RS11925 (2543763) | 2543763..2543915 | - | 153 | WP_002375510.1 | type I toxin-antitoxin system toxin PepG1 | - |
| M2924_RS11930 (2544140) | 2544140..2545111 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| M2924_RS11935 (2545286) | 2545286..2545723 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| M2924_RS11940 (2545856) | 2545856..2546410 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T244366 WP_023894767.1 NZ_CP097006:c2543492-2543388 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 133 bp
>AT244366 NZ_CP097006:2543089-2543221 [Enterococcus faecalis]
TGAAAAGAAAGATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTTACAAAAAATAACC
GTGCTTGATTAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
TGAAAAGAAAGATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTTACAAAAAATAACC
GTGCTTGATTAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|