Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2518268..2518648 | Replicon | chromosome |
Accession | NZ_CP097004 | ||
Organism | Enterococcus faecalis strain LS05-2 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | M2925_RS11965 | Protein ID | WP_023894767.1 |
Coordinates | 2518544..2518648 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2518268..2518382 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2925_RS11950 (2513856) | 2513856..2514569 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
M2925_RS11955 (2514830) | 2514830..2517574 | + | 2745 | WP_219259715.1 | glycosyl hydrolase family 65 protein | - |
M2925_RS11960 (2517589) | 2517589..2518239 | + | 651 | WP_002419627.1 | beta-phosphoglucomutase | - |
- (2518268) | 2518268..2518382 | + | 115 | NuclAT_11 | - | Antitoxin |
- (2518424) | 2518424..2518611 | + | 188 | NuclAT_4 | - | - |
M2925_RS11965 (2518544) | 2518544..2518648 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
- (2518800) | 2518800..2518942 | + | 143 | NuclAT_10 | - | - |
M2925_RS12880 (2519033) | 2519033..2519155 | - | 123 | WP_258536616.1 | hypothetical protein | - |
M2925_RS11970 (2519696) | 2519696..2519971 | + | 276 | WP_224805966.1 | CPBP family intramembrane metalloprotease | - |
M2925_RS11975 (2520027) | 2520027..2520998 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
M2925_RS11980 (2521173) | 2521173..2521610 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
M2925_RS11985 (2521743) | 2521743..2522297 | - | 555 | WP_010816844.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T244358 WP_023894767.1 NZ_CP097004:c2518648-2518544 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 115 bp
>AT244358 NZ_CP097004:2518268-2518382 [Enterococcus faecalis]
ACCTCTTTAGTGTAGAGCCGTTTAAGACGGTGACCGATTTTGTTACAAAAAATAACCGTACTCGATCAAAGTTGACGGTT
ATTTTTTATTGTCATTTTTAACAGCTTTTAGGATT
ACCTCTTTAGTGTAGAGCCGTTTAAGACGGTGACCGATTTTGTTACAAAAAATAACCGTACTCGATCAAAGTTGACGGTT
ATTTTTTATTGTCATTTTTAACAGCTTTTAGGATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|