Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 299715..299910 | Replicon | chromosome |
Accession | NZ_CP097004 | ||
Organism | Enterococcus faecalis strain LS05-2 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | M2925_RS01515 | Protein ID | WP_015543884.1 |
Coordinates | 299815..299910 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 299715..299779 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2925_RS01500 (295327) | 295327..297075 | + | 1749 | WP_002419225.1 | PTS transporter subunit EIIC | - |
M2925_RS01505 (297066) | 297066..299099 | + | 2034 | WP_002383677.1 | BglG family transcription antiterminator | - |
M2925_RS01510 (299110) | 299110..299544 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (299715) | 299715..299779 | + | 65 | NuclAT_12 | - | Antitoxin |
M2925_RS01515 (299815) | 299815..299910 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M2925_RS01520 (300156) | 300156..301928 | + | 1773 | WP_010816286.1 | PTS mannitol-specific transporter subunit IIBC | - |
M2925_RS01525 (301943) | 301943..302380 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
M2925_RS01530 (302395) | 302395..303549 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
M2925_RS01535 (303618) | 303618..304733 | - | 1116 | WP_219259638.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244352 WP_015543884.1 NZ_CP097004:c299910-299815 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244352 NZ_CP097004:299715-299779 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|