Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 303853..304047 | Replicon | chromosome |
Accession | NZ_CP097002 | ||
Organism | Enterococcus faecalis strain LS06-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | M2926_RS01520 | Protein ID | WP_015543884.1 |
Coordinates | 303952..304047 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 303853..303917 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2926_RS01505 | 299471..301213 | + | 1743 | WP_169062919.1 | PTS transporter subunit EIIC | - |
M2926_RS01510 | 301204..303237 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
M2926_RS01515 | 303248..303682 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 303853..303917 | + | 65 | - | - | Antitoxin |
M2926_RS01520 | 303952..304047 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M2926_RS01525 | 304293..306065 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
M2926_RS01530 | 306080..306517 | + | 438 | WP_142961037.1 | PTS sugar transporter subunit IIA | - |
M2926_RS01535 | 306532..307686 | + | 1155 | WP_142961038.1 | mannitol-1-phosphate 5-dehydrogenase | - |
M2926_RS01540 | 307755..308870 | - | 1116 | WP_142961039.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244341 WP_015543884.1 NZ_CP097002:c304047-303952 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244341 NZ_CP097002:303853-303917 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|