Detailed information of TA system TA244339

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 36093..36362
• Replicon: plasmid p17-07187_3
• Accession: NZ_CP096979
• Organism: Escherichia coli strain 17-07187

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M2894_RS26230
• Protein ID: WP_001372321.1
• Coordinates: 36237..36362 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	36093..36158 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M2894_RS26190	31096..31557	-	462	Protein_37	hypothetical protein	-
M2894_RS26195	31859..32386	+	528	Protein_38	single-stranded DNA-binding protein	-
M2894_RS26200	32444..32677	+	234	WP_000006003.1	DUF905 family protein	-
M2894_RS26205	32738..34705	+	1968	Protein_40	ParB/RepB/Spo0J family partition protein	-
M2894_RS26210	34774..35208	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M2894_RS26215	35205..35967	+	763	Protein_42	plasmid SOS inhibition protein A	-
-	35936..36160	+	225	NuclAT_0	-	-
-	35936..36160	+	225	NuclAT_0	-	-
-	35936..36160	+	225	NuclAT_0	-	-
-	35936..36160	+	225	NuclAT_0	-	-
M2894_RS26220	35945..36124	-	180	WP_001309233.1	hypothetical protein	-
-	36093..36158	-	66	-	-	Antitoxin
M2894_RS26225	36146..36295	+	150	Protein_44	plasmid maintenance protein Mok	-
M2894_RS26230	36237..36362	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M2894_RS26235	36681..36977	-	297	Protein_46	hypothetical protein	-
M2894_RS26240	37277..37573	+	297	WP_001272251.1	hypothetical protein	-
M2894_RS26245	37684..38505	+	822	WP_001234445.1	DUF932 domain-containing protein	-
M2894_RS26250	38802..39404	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
M2894_RS26255	39727..40110	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M2894_RS26260	40304..40975	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
M2894_RS26265	41112..41339	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T244339 WP_001372321.1 NZ_CP096979:36237-36362 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT244339 NZ_CP096979:c36158-36093 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin