Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5042539..5043141 | Replicon | chromosome |
Accession | NZ_CP096976 | ||
Organism | Escherichia coli strain 17-07187 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M2894_RS24530 | Protein ID | WP_000897305.1 |
Coordinates | 5042830..5043141 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2894_RS24525 | Protein ID | WP_000356397.1 |
Coordinates | 5042539..5042829 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2894_RS24500 (5038483) | 5038483..5039385 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M2894_RS24505 (5039382) | 5039382..5040017 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M2894_RS24510 (5040014) | 5040014..5040943 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M2894_RS24515 (5041273) | 5041273..5041515 | - | 243 | WP_001087409.1 | protein YiiF | - |
M2894_RS24520 (5041735) | 5041735..5041953 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
M2894_RS24525 (5042539) | 5042539..5042829 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M2894_RS24530 (5042830) | 5042830..5043141 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M2894_RS24535 (5043370) | 5043370..5044278 | + | 909 | WP_001387201.1 | alpha/beta hydrolase | - |
M2894_RS24540 (5044342) | 5044342..5045283 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M2894_RS24545 (5045328) | 5045328..5045765 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M2894_RS24550 (5045762) | 5045762..5046634 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M2894_RS24555 (5046628) | 5046628..5047227 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T244334 WP_000897305.1 NZ_CP096976:c5043141-5042830 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|