Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 929767..930338 Replicon chromosome
Accession NZ_CP096973
Organism Halomonas sp. ZZQ-149

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M0220_RS04335 Protein ID WP_030069598.1
Coordinates 930060..930338 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M0220_RS04330 Protein ID WP_030069600.1
Coordinates 929767..930060 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M0220_RS04300 (M0220_04285) 925691..926887 + 1197 WP_030069610.1 homoserine O-acetyltransferase -
M0220_RS04305 (M0220_04290) 927071..927724 - 654 WP_030069608.1 DsbA family oxidoreductase -
M0220_RS04310 (M0220_04295) 927836..928798 - 963 WP_264018783.1 ribonuclease Z -
M0220_RS04315 (M0220_04300) 928861..929262 - 402 WP_030069604.1 type II toxin-antitoxin system death-on-curing family toxin -
M0220_RS04320 (M0220_04305) 929262..929432 - 171 WP_030069602.1 hypothetical protein -
M0220_RS04325 (M0220_04310) 929490..929648 - 159 Protein_838 MBL fold metallo-hydrolase -
M0220_RS04330 (M0220_04315) 929767..930060 - 294 WP_030069600.1 HigA family addiction module antitoxin Antitoxin
M0220_RS04335 (M0220_04320) 930060..930338 - 279 WP_030069598.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M0220_RS04340 (M0220_04325) 930537..930800 - 264 WP_030069596.1 Txe/YoeB family addiction module toxin -
M0220_RS04345 (M0220_04330) 930793..931047 - 255 WP_030069594.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
M0220_RS04350 (M0220_04335) 931407..931631 - 225 WP_264018784.1 Txe/YoeB family addiction module toxin -
M0220_RS04355 (M0220_04340) 931628..931870 - 243 Protein_844 type II toxin-antitoxin system Phd/YefM family antitoxin -
M0220_RS04360 (M0220_04345) 932015..932398 - 384 WP_264018785.1 hypothetical protein -
M0220_RS04365 (M0220_04350) 932554..933420 - 867 WP_264018786.1 hypothetical protein -
M0220_RS04370 (M0220_04355) 933417..934646 - 1230 WP_030069590.1 hypothetical protein -
M0220_RS04375 (M0220_04360) 934643..935272 - 630 WP_264018787.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(3-92)

Antitoxin

Cro/C1-type helix-turn-helix domain

(18-66)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10719.25 Da        Isoelectric Point: 10.0575

>T244307 WP_030069598.1 NZ_CP096973:c930338-930060 [Halomonas sp. ZZQ-149]
MIKSFRHKGLKRFYASGSTAGIQADHAKKLRMQLAALDTAVSVEDMDIPGFRLHPLKGRDKARWSIWVNGNWRMTFEFRD
GNAYILDYEDYH

Download         Length: 279 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10905.51 Da        Isoelectric Point: 4.7164

>AT244307 WP_030069600.1 NZ_CP096973:c930060-929767 [Halomonas sp. ZZQ-149]
MTMHNPPHPGEFIREVYLEPFGISSRQLASNLGVSPSTLSRLLKGDSGISPEMSLRLSKVLGRTPESWLLMQDMYDLWMA
RSTINLDDLQPLDFEAA

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References