Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1274028..1274650 | Replicon | chromosome |
Accession | NZ_CP096964 | ||
Organism | Pseudomonas aeruginosa strain NY13936 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M2J01_RS05980 | Protein ID | WP_023910260.1 |
Coordinates | 1274028..1274342 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2J01_RS05985 | Protein ID | WP_023910258.1 |
Coordinates | 1274345..1274650 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J01_RS05950 (M2J01_05950) | 1269064..1270020 | + | 957 | WP_236079379.1 | site-specific integrase | - |
M2J01_RS05955 (M2J01_05955) | 1270089..1270400 | + | 312 | WP_031631670.1 | outer membrane protein assembly factor BamE | - |
M2J01_RS05960 (M2J01_05960) | 1270532..1271182 | + | 651 | WP_058172679.1 | BRCT domain-containing protein | - |
M2J01_RS05965 (M2J01_05965) | 1271280..1271558 | + | 279 | WP_121333592.1 | hypothetical protein | - |
M2J01_RS05970 (M2J01_05970) | 1271619..1272781 | + | 1163 | WP_086937300.1 | IS3-like element IS222 family transposase | - |
M2J01_RS05975 (M2J01_05975) | 1272801..1273250 | - | 450 | WP_058167335.1 | GNAT family N-acetyltransferase | - |
M2J01_RS05980 (M2J01_05980) | 1274028..1274342 | + | 315 | WP_023910260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2J01_RS05985 (M2J01_05985) | 1274345..1274650 | + | 306 | WP_023910258.1 | helix-turn-helix domain-containing protein | Antitoxin |
M2J01_RS05990 (M2J01_05990) | 1274711..1275010 | - | 300 | WP_058172668.1 | hypothetical protein | - |
M2J01_RS05995 (M2J01_05995) | 1275111..1275323 | - | 213 | WP_121333665.1 | hypothetical protein | - |
M2J01_RS06000 (M2J01_06000) | 1275320..1277200 | - | 1881 | WP_121333664.1 | DNA cytosine methyltransferase | - |
M2J01_RS06005 (M2J01_06005) | 1277197..1277676 | - | 480 | WP_023094641.1 | hypothetical protein | - |
M2J01_RS06010 (M2J01_06010) | 1277686..1277925 | - | 240 | WP_019396882.1 | hypothetical protein | - |
M2J01_RS06015 (M2J01_06015) | 1277922..1278548 | - | 627 | WP_121333387.1 | hypothetical protein | - |
M2J01_RS06020 (M2J01_06020) | 1278599..1278916 | - | 318 | WP_019726489.1 | pyocin activator PrtN family protein | - |
M2J01_RS06025 (M2J01_06025) | 1278913..1279143 | - | 231 | WP_019726488.1 | hypothetical protein | - |
M2J01_RS06030 (M2J01_06030) | 1279294..1279587 | - | 294 | WP_121337895.1 | phage antirepressor KilAC domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1264963..1313053 | 48090 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11776.54 Da Isoelectric Point: 9.4385
>T244291 WP_023910260.1 NZ_CP096964:1274028-1274342 [Pseudomonas aeruginosa]
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|