Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5393929..5394524 | Replicon | chromosome |
Accession | NZ_CP096961 | ||
Organism | Pseudomonas aeruginosa strain NY13932 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | M2J00_RS25000 | Protein ID | WP_003113526.1 |
Coordinates | 5394246..5394524 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2J00_RS24995 | Protein ID | WP_003113527.1 |
Coordinates | 5393929..5394234 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J00_RS24975 (M2J00_24915) | 5389260..5389550 | - | 291 | WP_270036334.1 | DUF5447 family protein | - |
M2J00_RS24980 (M2J00_24920) | 5389762..5390034 | - | 273 | WP_003115921.1 | hypothetical protein | - |
M2J00_RS24985 (M2J00_24925) | 5390481..5390816 | + | 336 | WP_121496269.1 | hypothetical protein | - |
M2J00_RS24990 (M2J00_24930) | 5390890..5393250 | - | 2361 | WP_162950028.1 | ATP-binding protein | - |
M2J00_RS24995 (M2J00_24935) | 5393929..5394234 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M2J00_RS25000 (M2J00_24940) | 5394246..5394524 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2J00_RS25005 (M2J00_24945) | 5394577..5394705 | - | 129 | Protein_4939 | integrase | - |
M2J00_RS25010 (M2J00_24950) | 5394853..5397081 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M2J00_RS25015 (M2J00_24955) | 5397151..5397798 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2J00_RS25020 (M2J00_24960) | 5397860..5399098 | - | 1239 | WP_023084819.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244288 WP_003113526.1 NZ_CP096961:c5394524-5394246 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|