Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4711079..4711760 | Replicon | chromosome |
Accession | NZ_CP096961 | ||
Organism | Pseudomonas aeruginosa strain NY13932 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | M2J00_RS21800 | Protein ID | WP_003111825.1 |
Coordinates | 4711395..4711760 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2J00_RS21795 | Protein ID | WP_003145733.1 |
Coordinates | 4711079..4711402 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J00_RS21770 (M2J00_21720) | 4706992..4707630 | + | 639 | WP_003109444.1 | hypothetical protein | - |
M2J00_RS21775 (M2J00_21725) | 4707873..4708208 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
M2J00_RS21780 (M2J00_21730) | 4708382..4708900 | + | 519 | WP_128654462.1 | PAAR domain-containing protein | - |
M2J00_RS21785 (M2J00_21735) | 4708897..4709598 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
M2J00_RS21790 (M2J00_21740) | 4709615..4710703 | + | 1089 | WP_034025227.1 | DUF3396 domain-containing protein | - |
M2J00_RS21795 (M2J00_21745) | 4711079..4711402 | - | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
M2J00_RS21800 (M2J00_21750) | 4711395..4711760 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2J00_RS21805 (M2J00_21755) | 4712024..4712263 | - | 240 | WP_049876884.1 | hypothetical protein | - |
M2J00_RS21810 (M2J00_21760) | 4712470..4712742 | + | 273 | WP_003085667.1 | hypothetical protein | - |
M2J00_RS21815 (M2J00_21765) | 4712761..4713186 | - | 426 | WP_003114206.1 | VOC family protein | - |
M2J00_RS21820 (M2J00_21770) | 4713287..4714171 | + | 885 | WP_128654463.1 | LysR substrate-binding domain-containing protein | - |
M2J00_RS21825 (M2J00_21775) | 4714144..4715097 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
M2J00_RS21830 (M2J00_21780) | 4715318..4715752 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T244287 WP_003111825.1 NZ_CP096961:c4711760-4711395 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|