Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5980967..5981562 | Replicon | chromosome |
Accession | NZ_CP096960 | ||
Organism | Pseudomonas aeruginosa strain NY11254 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | M2I99_RS28225 | Protein ID | WP_003113526.1 |
Coordinates | 5981284..5981562 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I99_RS28220 | Protein ID | WP_003133769.1 |
Coordinates | 5980967..5981272 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I99_RS28205 (M2I99_28140) | 5977673..5978536 | - | 864 | WP_031761182.1 | integrase domain-containing protein | - |
M2I99_RS28210 (M2I99_28145) | 5979137..5980294 | - | 1158 | WP_031761183.1 | STY4528 family pathogenicity island replication protein | - |
M2I99_RS28220 (M2I99_28155) | 5980967..5981272 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
M2I99_RS28225 (M2I99_28160) | 5981284..5981562 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I99_RS28230 (M2I99_28165) | 5981615..5981743 | - | 129 | Protein_5581 | integrase | - |
M2I99_RS28235 (M2I99_28170) | 5981891..5984119 | + | 2229 | WP_023104079.1 | TonB-dependent receptor | - |
M2I99_RS28240 (M2I99_28175) | 5984190..5984837 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I99_RS28245 (M2I99_28180) | 5984899..5986137 | - | 1239 | WP_003095023.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244281 WP_003113526.1 NZ_CP096960:c5981562-5981284 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|