Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5830532..5831127 | Replicon | chromosome |
Accession | NZ_CP096958 | ||
Organism | Pseudomonas aeruginosa strain NY11210 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | M2I98_RS27480 | Protein ID | WP_003117425.1 |
Coordinates | 5830849..5831127 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I98_RS27475 | Protein ID | WP_003113527.1 |
Coordinates | 5830532..5830837 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I98_RS27440 (M2I98_27385) | 5825672..5826520 | + | 849 | WP_023122792.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
M2I98_RS27450 (M2I98_27395) | 5826687..5827628 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
M2I98_RS27455 (M2I98_27400) | 5827745..5828359 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
M2I98_RS27460 (M2I98_27405) | 5828401..5828985 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
M2I98_RS27465 (M2I98_27410) | 5829026..5830126 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
M2I98_RS27475 (M2I98_27420) | 5830532..5830837 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M2I98_RS27480 (M2I98_27425) | 5830849..5831127 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I98_RS27485 (M2I98_27430) | 5831180..5831308 | - | 129 | Protein_5435 | integrase | - |
M2I98_RS27490 (M2I98_27435) | 5831456..5833684 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M2I98_RS27495 (M2I98_27440) | 5833754..5834401 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I98_RS27500 (M2I98_27445) | 5834463..5835701 | - | 1239 | WP_031685043.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T244272 WP_003117425.1 NZ_CP096958:c5831127-5830849 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|