Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4822294..4822975 | Replicon | chromosome |
Accession | NZ_CP096956 | ||
Organism | Pseudomonas aeruginosa strain NY11173 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M2I96_RS22525 | Protein ID | WP_015503432.1 |
Coordinates | 4822610..4822975 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I96_RS22520 | Protein ID | WP_016561576.1 |
Coordinates | 4822294..4822617 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I96_RS22485 (M2I96_22415) | 4817915..4818793 | + | 879 | WP_003109435.1 | hypothetical protein | - |
M2I96_RS22495 (M2I96_22425) | 4819305..4820171 | - | 867 | WP_023081971.1 | hypothetical protein | - |
M2I96_RS22500 (M2I96_22430) | 4820201..4820452 | - | 252 | WP_124136459.1 | hypothetical protein | - |
M2I96_RS22505 (M2I96_22435) | 4820669..4821672 | - | 1004 | Protein_4452 | tyrosine-type recombinase/integrase | - |
M2I96_RS22510 (M2I96_22440) | 4821672..4822064 | - | 393 | Protein_4453 | hypothetical protein | - |
M2I96_RS22515 (M2I96_22445) | 4822059..4822178 | + | 120 | Protein_4454 | IS5/IS1182 family transposase | - |
M2I96_RS22520 (M2I96_22450) | 4822294..4822617 | - | 324 | WP_016561576.1 | XRE family transcriptional regulator | Antitoxin |
M2I96_RS22525 (M2I96_22455) | 4822610..4822975 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I96_RS22530 (M2I96_22460) | 4823239..4823481 | - | 243 | WP_043884955.1 | hypothetical protein | - |
M2I96_RS22535 (M2I96_22465) | 4823688..4823960 | + | 273 | WP_003085667.1 | hypothetical protein | - |
M2I96_RS22540 (M2I96_22470) | 4823979..4824404 | - | 426 | WP_003163196.1 | VOC family protein | - |
M2I96_RS22545 (M2I96_22475) | 4824505..4825389 | + | 885 | WP_019725847.1 | LysR substrate-binding domain-containing protein | - |
M2I96_RS22550 (M2I96_22480) | 4825362..4826315 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
M2I96_RS22555 (M2I96_22485) | 4826536..4826970 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T244263 WP_015503432.1 NZ_CP096956:c4822975-4822610 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|