Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5781962..5782557 | Replicon | chromosome |
| Accession | NZ_CP096953 | ||
| Organism | Pseudomonas aeruginosa strain NY5535 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | M2I95_RS27675 | Protein ID | WP_003117425.1 |
| Coordinates | 5782279..5782557 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M2I95_RS27670 | Protein ID | WP_003113527.1 |
| Coordinates | 5781962..5782267 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I95_RS27635 (M2I95_27505) | 5777102..5777950 | + | 849 | WP_023122792.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| M2I95_RS27645 (M2I95_27515) | 5778117..5779058 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| M2I95_RS27650 (M2I95_27520) | 5779175..5779789 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| M2I95_RS27655 (M2I95_27525) | 5779831..5780415 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| M2I95_RS27660 (M2I95_27530) | 5780456..5781556 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| M2I95_RS27670 (M2I95_27540) | 5781962..5782267 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| M2I95_RS27675 (M2I95_27545) | 5782279..5782557 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I95_RS27680 (M2I95_27550) | 5782610..5782738 | - | 129 | Protein_5474 | integrase | - |
| M2I95_RS27685 (M2I95_27555) | 5782886..5785114 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| M2I95_RS27690 (M2I95_27560) | 5785184..5785831 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M2I95_RS27695 (M2I95_27565) | 5785893..5787131 | - | 1239 | WP_031685043.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T244258 WP_003117425.1 NZ_CP096953:c5782557-5782279 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|