Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5758043..5758638 | Replicon | chromosome |
| Accession | NZ_CP096950 | ||
| Organism | Pseudomonas aeruginosa strain NY5532 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | M2I94_RS27265 | Protein ID | WP_003113526.1 |
| Coordinates | 5758360..5758638 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M2I94_RS27260 | Protein ID | WP_003113527.1 |
| Coordinates | 5758043..5758348 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I94_RS27240 (M2I94_27145) | 5754119..5754376 | + | 258 | WP_010793759.1 | ATP-binding protein | - |
| M2I94_RS27245 (M2I94_27150) | 5754752..5755615 | - | 864 | WP_010793758.1 | integrase domain-containing protein | - |
| M2I94_RS27250 (M2I94_27155) | 5756217..5757359 | - | 1143 | WP_010793757.1 | STY4528 family pathogenicity island replication protein | - |
| M2I94_RS27260 (M2I94_27165) | 5758043..5758348 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| M2I94_RS27265 (M2I94_27170) | 5758360..5758638 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I94_RS27270 (M2I94_27175) | 5758691..5758819 | - | 129 | Protein_5391 | integrase | - |
| M2I94_RS27275 (M2I94_27180) | 5758967..5761195 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| M2I94_RS27280 (M2I94_27185) | 5761265..5761912 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M2I94_RS27285 (M2I94_27190) | 5761974..5763212 | - | 1239 | WP_010793756.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244251 WP_003113526.1 NZ_CP096950:c5758638-5758360 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|