Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5816265..5816860 | Replicon | chromosome |
Accession | NZ_CP096946 | ||
Organism | Pseudomonas aeruginosa strain NY5530 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M2I93_RS27345 | Protein ID | WP_270004088.1 |
Coordinates | 5816582..5816860 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I93_RS27340 | Protein ID | WP_003113527.1 |
Coordinates | 5816265..5816570 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I93_RS27305 (M2I93_27260) | 5811405..5812253 | + | 849 | WP_023122792.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
M2I93_RS27315 (M2I93_27270) | 5812420..5813361 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
M2I93_RS27320 (M2I93_27275) | 5813478..5814092 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
M2I93_RS27325 (M2I93_27280) | 5814134..5814718 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
M2I93_RS27330 (M2I93_27285) | 5814759..5815859 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
M2I93_RS27340 (M2I93_27295) | 5816265..5816570 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M2I93_RS27345 (M2I93_27300) | 5816582..5816860 | - | 279 | WP_270004088.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I93_RS27350 (M2I93_27305) | 5816913..5817041 | - | 129 | Protein_5408 | integrase | - |
M2I93_RS27355 (M2I93_27310) | 5817189..5819417 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M2I93_RS27360 (M2I93_27315) | 5819487..5820134 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I93_RS27365 (M2I93_27320) | 5820196..5821434 | - | 1239 | WP_270030464.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10671.25 Da Isoelectric Point: 8.5576
>T244243 WP_270004088.1 NZ_CP096946:c5816860-5816582 [Pseudomonas aeruginosa]
MILAFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILAFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|