Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5681825..5682420 | Replicon | chromosome |
Accession | NZ_CP096945 | ||
Organism | Pseudomonas aeruginosa strain NY5525 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | M2I92_RS27315 | Protein ID | WP_003117425.1 |
Coordinates | 5682142..5682420 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I92_RS27310 | Protein ID | WP_003113527.1 |
Coordinates | 5681825..5682130 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I92_RS27270 (M2I92_27190) | 5676989..5677280 | - | 292 | Protein_5393 | DUF5447 family protein | - |
M2I92_RS27275 (M2I92_27195) | 5677284..5677496 | - | 213 | WP_058181545.1 | hypothetical protein | - |
M2I92_RS27280 (M2I92_27200) | 5677498..5677713 | - | 216 | WP_058181544.1 | DNA-binding protein | - |
M2I92_RS27285 (M2I92_27205) | 5677847..5678114 | + | 268 | Protein_5396 | DNA-binding protein | - |
M2I92_RS27290 (M2I92_27210) | 5678259..5678780 | + | 522 | WP_152992837.1 | hypothetical protein | - |
M2I92_RS27295 (M2I92_27215) | 5678824..5679426 | - | 603 | WP_071538272.1 | hypothetical protein | - |
M2I92_RS27300 (M2I92_27220) | 5679591..5680391 | + | 801 | WP_283859153.1 | protein kinase | - |
M2I92_RS27305 (M2I92_27225) | 5680388..5681461 | + | 1074 | WP_003113528.1 | serine/threonine-protein kinase | - |
M2I92_RS27310 (M2I92_27230) | 5681825..5682130 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M2I92_RS27315 (M2I92_27235) | 5682142..5682420 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I92_RS27320 (M2I92_27240) | 5682473..5682601 | - | 129 | Protein_5403 | integrase | - |
M2I92_RS27325 (M2I92_27245) | 5682749..5684977 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M2I92_RS27330 (M2I92_27250) | 5685047..5685694 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I92_RS27335 (M2I92_27255) | 5685756..5686994 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T244238 WP_003117425.1 NZ_CP096945:c5682420-5682142 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|