Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6112385..6112980 | Replicon | chromosome |
Accession | NZ_CP096942 | ||
Organism | Pseudomonas aeruginosa strain NY5524 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | M2I87_RS29510 | Protein ID | WP_003113526.1 |
Coordinates | 6112702..6112980 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I87_RS29505 | Protein ID | WP_003113527.1 |
Coordinates | 6112385..6112690 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I87_RS29485 (M2I87_29350) | 6108461..6108718 | + | 258 | WP_010793759.1 | ATP-binding protein | - |
M2I87_RS29490 (M2I87_29355) | 6109094..6109957 | - | 864 | WP_010793758.1 | integrase domain-containing protein | - |
M2I87_RS29495 (M2I87_29360) | 6110559..6111701 | - | 1143 | WP_010793757.1 | STY4528 family pathogenicity island replication protein | - |
M2I87_RS29505 (M2I87_29370) | 6112385..6112690 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M2I87_RS29510 (M2I87_29375) | 6112702..6112980 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I87_RS29515 (M2I87_29380) | 6113033..6113161 | - | 129 | Protein_5839 | integrase | - |
M2I87_RS29520 (M2I87_29385) | 6113309..6115537 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M2I87_RS29525 (M2I87_29390) | 6115607..6116254 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I87_RS29530 (M2I87_29395) | 6116316..6117554 | - | 1239 | WP_010793756.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244231 WP_003113526.1 NZ_CP096942:c6112980-6112702 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|