Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5556500..5557095 | Replicon | chromosome |
Accession | NZ_CP096937 | ||
Organism | Pseudomonas aeruginosa strain NY5520 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | M2I89_RS26325 | Protein ID | WP_003117425.1 |
Coordinates | 5556817..5557095 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I89_RS26320 | Protein ID | WP_003113527.1 |
Coordinates | 5556500..5556805 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I89_RS26285 (M2I89_26225) | 5551640..5552488 | + | 849 | WP_023122792.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
M2I89_RS26295 (M2I89_26235) | 5552655..5553596 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
M2I89_RS26300 (M2I89_26240) | 5553713..5554327 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
M2I89_RS26305 (M2I89_26245) | 5554369..5554953 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
M2I89_RS26310 (M2I89_26250) | 5554994..5556094 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
M2I89_RS26320 (M2I89_26260) | 5556500..5556805 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M2I89_RS26325 (M2I89_26265) | 5556817..5557095 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I89_RS26330 (M2I89_26270) | 5557148..5557276 | - | 129 | Protein_5204 | integrase | - |
M2I89_RS26335 (M2I89_26275) | 5557424..5559652 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M2I89_RS26340 (M2I89_26280) | 5559722..5560369 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I89_RS26345 (M2I89_26285) | 5560431..5561669 | - | 1239 | WP_031685043.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T244215 WP_003117425.1 NZ_CP096937:c5557095-5556817 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|