Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5709551..5710146 | Replicon | chromosome |
| Accession | NZ_CP096932 | ||
| Organism | Pseudomonas aeruginosa strain NY5510 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | M2I84_RS27105 | Protein ID | WP_003117425.1 |
| Coordinates | 5709868..5710146 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M2I84_RS27100 | Protein ID | WP_003113527.1 |
| Coordinates | 5709551..5709856 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I84_RS27065 (M2I84_27000) | 5704691..5705539 | + | 849 | WP_023122792.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| M2I84_RS27075 (M2I84_27010) | 5705706..5706647 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| M2I84_RS27080 (M2I84_27015) | 5706764..5707378 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| M2I84_RS27085 (M2I84_27020) | 5707420..5708004 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| M2I84_RS27090 (M2I84_27025) | 5708045..5709145 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| M2I84_RS27100 (M2I84_27035) | 5709551..5709856 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| M2I84_RS27105 (M2I84_27040) | 5709868..5710146 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I84_RS27110 (M2I84_27045) | 5710199..5710327 | - | 129 | Protein_5360 | integrase | - |
| M2I84_RS27115 (M2I84_27050) | 5710475..5712703 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| M2I84_RS27120 (M2I84_27055) | 5712773..5713420 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M2I84_RS27125 (M2I84_27060) | 5713482..5714720 | - | 1239 | WP_031685043.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T244205 WP_003117425.1 NZ_CP096932:c5710146-5709868 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|