Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5816935..5817530 | Replicon | chromosome |
| Accession | NZ_CP096929 | ||
| Organism | Pseudomonas aeruginosa strain NY5507 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M2I83_RS27370 | Protein ID | WP_270004088.1 |
| Coordinates | 5817252..5817530 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M2I83_RS27365 | Protein ID | WP_003113527.1 |
| Coordinates | 5816935..5817240 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I83_RS27330 (M2I83_27285) | 5812075..5812923 | + | 849 | WP_023122792.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| M2I83_RS27340 (M2I83_27295) | 5813090..5814031 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| M2I83_RS27345 (M2I83_27300) | 5814148..5814762 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| M2I83_RS27350 (M2I83_27305) | 5814804..5815388 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| M2I83_RS27355 (M2I83_27310) | 5815429..5816529 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| M2I83_RS27365 (M2I83_27320) | 5816935..5817240 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| M2I83_RS27370 (M2I83_27325) | 5817252..5817530 | - | 279 | WP_270004088.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I83_RS27375 (M2I83_27330) | 5817583..5817711 | - | 129 | Protein_5413 | integrase | - |
| M2I83_RS27380 (M2I83_27335) | 5817859..5820087 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| M2I83_RS27385 (M2I83_27340) | 5820157..5820804 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M2I83_RS27390 (M2I83_27345) | 5820866..5822104 | - | 1239 | WP_270030464.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10671.25 Da Isoelectric Point: 8.5576
>T244200 WP_270004088.1 NZ_CP096929:c5817530-5817252 [Pseudomonas aeruginosa]
MILAFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILAFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|