Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5308895..5309490 | Replicon | chromosome |
Accession | NZ_CP096927 | ||
Organism | Pseudomonas aeruginosa strain NY5506 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | M2I82_RS24630 | Protein ID | WP_003113526.1 |
Coordinates | 5309212..5309490 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2I82_RS24625 | Protein ID | WP_003099268.1 |
Coordinates | 5308895..5309200 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I82_RS24590 (M2I82_24525) | 5304035..5304883 | + | 849 | WP_023115601.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
M2I82_RS24600 (M2I82_24535) | 5305050..5305991 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
M2I82_RS24605 (M2I82_24540) | 5306108..5306722 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
M2I82_RS24610 (M2I82_24545) | 5306764..5307348 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
M2I82_RS24615 (M2I82_24550) | 5307389..5308489 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
M2I82_RS24625 (M2I82_24560) | 5308895..5309200 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
M2I82_RS24630 (M2I82_24565) | 5309212..5309490 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I82_RS24635 (M2I82_24570) | 5309543..5309671 | - | 129 | Protein_4866 | integrase | - |
M2I82_RS24640 (M2I82_24575) | 5309819..5312047 | + | 2229 | WP_031633241.1 | TonB-dependent receptor | - |
M2I82_RS24645 (M2I82_24580) | 5312117..5312764 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2I82_RS24650 (M2I82_24585) | 5312826..5314064 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244194 WP_003113526.1 NZ_CP096927:c5309490-5309212 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|