Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 2074175..2074761 Replicon chromosome
Accession NZ_CP096918
Organism Comamonas aquatica strain NY8661

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M2J84_RS09910 Protein ID WP_151046138.1
Coordinates 2074483..2074761 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M2J84_RS09905 Protein ID WP_270146902.1
Coordinates 2074175..2074471 (-) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2J84_RS09870 (M2J84_09880) 2069457..2069732 - 276 WP_151046154.1 hypothetical protein -
M2J84_RS09875 (M2J84_09885) 2069807..2070124 - 318 WP_270146896.1 hypothetical protein -
M2J84_RS09880 (M2J84_09890) 2070580..2071209 - 630 WP_151046150.1 DUF3275 family protein -
M2J84_RS09885 (M2J84_09895) 2071579..2072217 - 639 WP_260675704.1 DUF3577 domain-containing protein -
M2J84_RS09890 (M2J84_09900) 2072452..2073030 - 579 WP_270146899.1 hypothetical protein -
M2J84_RS09895 (M2J84_09905) 2073110..2073547 - 438 WP_151046144.1 hypothetical protein -
M2J84_RS09900 (M2J84_09910) 2073821..2074111 + 291 WP_151046142.1 H-NS histone family protein -
M2J84_RS09905 (M2J84_09915) 2074175..2074471 - 297 WP_270146902.1 HigA family addiction module antitoxin Antitoxin
M2J84_RS09910 (M2J84_09920) 2074483..2074761 - 279 WP_151046138.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M2J84_RS09915 (M2J84_09925) 2074843..2075280 + 438 WP_270146905.1 thermonuclease family protein -
M2J84_RS09920 (M2J84_09930) 2075346..2075597 - 252 Protein_1912 integrase core domain-containing protein -
M2J84_RS09925 (M2J84_09935) 2075719..2077245 + 1527 WP_031632314.1 IS21 family transposase -
M2J84_RS09930 (M2J84_09940) 2077235..2078032 + 798 WP_269199104.1 IS21-like element helper ATPase IstB -
M2J84_RS09935 (M2J84_09945) 2078117..2079036 - 920 Protein_1915 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul1 / aph(6)-Id / aph(3'')-Ib / mph(E) / msr(E) / blaIMP-8 - 2033658..2150304 116646
- inside Genomic island sul1 / aph(6)-Id / aph(3'')-Ib / mph(E) / msr(E) / blaIMP-8 - 1977429..2150304 172875


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(1-92)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(4-80)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10403.89 Da        Isoelectric Point: 10.2785

>T244170 WP_151046138.1 NZ_CP096918:c2074761-2074483 [Comamonas aquatica]
MIKSFRHKGLQRYFETGSKAGIQAAHAARLRLQLAALNQATRPEDLSAPAWALHPLKGDLKGHWAITVNGNWRMVFTFEG
TDAVLVDYRDYH

Download         Length: 279 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 10833.40 Da        Isoelectric Point: 8.5693

>AT244170 WP_270146902.1 NZ_CP096918:c2074471-2074175 [Comamonas aquatica]
MSKMFNPPHPGEVLRDYLGEVTVTDAAKQLGVNRVTLNRIVSGHSGISPDMAYRLADAFGTSAELWAGLQMQYDLFQAAQ
QKRPHIARFSMNNLLASI

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References