Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 6042853..6043448 | Replicon | chromosome |
Accession | NZ_CP096913 | ||
Organism | Pseudomonas aeruginosa strain NY7610 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | M2J79_RS28525 | Protein ID | WP_003113526.1 |
Coordinates | 6043170..6043448 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M2J79_RS28520 | Protein ID | WP_003133769.1 |
Coordinates | 6042853..6043158 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J79_RS28490 (M2J79_28460) | 6037967..6038920 | - | 954 | WP_023085605.1 | PDR/VanB family oxidoreductase | - |
M2J79_RS28495 (M2J79_28465) | 6038921..6039958 | - | 1038 | WP_023085606.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
M2J79_RS28500 (M2J79_28470) | 6039980..6040858 | - | 879 | WP_023085607.1 | polysaccharide deacetylase | - |
M2J79_RS28505 (M2J79_28475) | 6040884..6041633 | - | 750 | WP_023085608.1 | SDR family oxidoreductase | - |
M2J79_RS28510 (M2J79_28480) | 6041635..6042330 | - | 696 | WP_023085609.1 | SDR family oxidoreductase | - |
M2J79_RS28520 (M2J79_28490) | 6042853..6043158 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
M2J79_RS28525 (M2J79_28495) | 6043170..6043448 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2J79_RS28530 (M2J79_28500) | 6043501..6043629 | - | 129 | Protein_5642 | integrase | - |
M2J79_RS28535 (M2J79_28505) | 6043777..6046005 | + | 2229 | WP_003141628.1 | TonB-dependent receptor | - |
M2J79_RS28540 (M2J79_28510) | 6046075..6046722 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M2J79_RS28545 (M2J79_28515) | 6046784..6048022 | - | 1239 | WP_003141631.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244163 WP_003113526.1 NZ_CP096913:c6043448-6043170 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|