Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5450231..5450826 | Replicon | chromosome |
| Accession | NZ_CP096912 | ||
| Organism | Pseudomonas aeruginosa strain NY7770 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | M2J78_RS25360 | Protein ID | WP_003113526.1 |
| Coordinates | 5450548..5450826 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | M2J78_RS25355 | Protein ID | WP_003111575.1 |
| Coordinates | 5450231..5450536 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J78_RS25325 (M2J78_25295) | 5445588..5446343 | + | 756 | WP_074198791.1 | IS21-like element ISPpu7 family helper ATPase IstB | - |
| M2J78_RS25330 (M2J78_25300) | 5446693..5447346 | - | 654 | WP_073651898.1 | hypothetical protein | - |
| M2J78_RS25335 (M2J78_25305) | 5447490..5447729 | + | 240 | WP_011806687.1 | helix-turn-helix transcriptional regulator | - |
| M2J78_RS25340 (M2J78_25310) | 5448458..5449330 | - | 873 | WP_212591743.1 | plasmid replication initiator TrfA | - |
| M2J78_RS25345 (M2J78_25315) | 5449366..5449578 | - | 213 | WP_058133021.1 | AlpA family phage regulatory protein | - |
| M2J78_RS25355 (M2J78_25325) | 5450231..5450536 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| M2J78_RS25360 (M2J78_25330) | 5450548..5450826 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2J78_RS25365 (M2J78_25335) | 5450879..5451007 | - | 129 | Protein_5011 | integrase | - |
| M2J78_RS25370 (M2J78_25340) | 5451155..5453383 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| M2J78_RS25375 (M2J78_25345) | 5453453..5454100 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M2J78_RS25380 (M2J78_25350) | 5454162..5455400 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T244156 WP_003113526.1 NZ_CP096912:c5450826-5450548 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |