Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5765951..5766546 | Replicon | chromosome |
| Accession | NZ_CP096909 | ||
| Organism | Pseudomonas aeruginosa strain NY8688 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M2J77_RS27135 | Protein ID | WP_071538299.1 |
| Coordinates | 5766268..5766546 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M2J77_RS27130 | Protein ID | WP_003123432.1 |
| Coordinates | 5765951..5766256 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J77_RS27085 (M2J77_27020) | 5761953..5762018 | - | 66 | Protein_5355 | hypothetical protein | - |
| M2J77_RS27090 (M2J77_27025) | 5762088..5762315 | - | 228 | WP_153274454.1 | hypothetical protein | - |
| M2J77_RS27095 (M2J77_27030) | 5762369..5762899 | - | 531 | WP_256824629.1 | 3'-5' exonuclease | - |
| M2J77_RS27100 (M2J77_27035) | 5762989..5763480 | - | 492 | WP_130027294.1 | HAD domain-containing protein | - |
| M2J77_RS27105 (M2J77_27040) | 5763477..5764046 | - | 570 | WP_130027295.1 | HAD-IA family hydrolase | - |
| M2J77_RS27110 (M2J77_27045) | 5764057..5764260 | - | 204 | WP_130027297.1 | hypothetical protein | - |
| M2J77_RS27115 (M2J77_27050) | 5764262..5764822 | - | 561 | WP_130027299.1 | hypothetical protein | - |
| M2J77_RS27120 (M2J77_27055) | 5764853..5765263 | + | 411 | WP_130027301.1 | hypothetical protein | - |
| M2J77_RS27130 (M2J77_27065) | 5765951..5766256 | - | 306 | WP_003123432.1 | HigA family addiction module antitoxin | Antitoxin |
| M2J77_RS27135 (M2J77_27070) | 5766268..5766546 | - | 279 | WP_071538299.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2J77_RS27140 (M2J77_27075) | 5766599..5766727 | - | 129 | Protein_5365 | integrase | - |
| M2J77_RS27145 (M2J77_27080) | 5766875..5769103 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| M2J77_RS27150 (M2J77_27085) | 5769173..5769820 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M2J77_RS27155 (M2J77_27090) | 5769882..5771120 | - | 1239 | WP_003123433.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10616.17 Da Isoelectric Point: 7.8937
>T244149 WP_071538299.1 NZ_CP096909:c5766546-5766268 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|