Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4361870..4362686 | Replicon | chromosome |
| Accession | NZ_CP096905 | ||
| Organism | Citrobacter amalonaticus strain RSHH22 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9VGC4 |
| Locus tag | M2R49_RS21045 | Protein ID | WP_044327726.1 |
| Coordinates | 4361870..4362346 (-) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A3Q8DNJ3 |
| Locus tag | M2R49_RS21050 | Protein ID | WP_042999108.1 |
| Coordinates | 4362351..4362686 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2R49_RS21025 (M2R49_21010) | 4356975..4357718 | - | 744 | WP_044264050.1 | molecular chaperone | - |
| M2R49_RS21030 (M2R49_21015) | 4357761..4360205 | - | 2445 | WP_224267598.1 | fimbria/pilus outer membrane usher protein | - |
| M2R49_RS21035 (M2R49_21020) | 4360299..4360847 | - | 549 | WP_052443907.1 | fimbrial protein | - |
| M2R49_RS21040 (M2R49_21025) | 4360916..4361446 | - | 531 | WP_042999110.1 | fimbrial protein | - |
| M2R49_RS21045 (M2R49_21030) | 4361870..4362346 | - | 477 | WP_044327726.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| M2R49_RS21050 (M2R49_21035) | 4362351..4362686 | - | 336 | WP_042999108.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| M2R49_RS21055 (M2R49_21040) | 4362901..4363437 | - | 537 | WP_042999107.1 | ferredoxin-type protein NapF | - |
| M2R49_RS21060 (M2R49_21045) | 4363434..4364030 | - | 597 | WP_054176702.1 | molecular chaperone | - |
| M2R49_RS21065 (M2R49_21050) | 4364075..4364848 | - | 774 | WP_054176703.1 | dimethyl sulfoxide reductase anchor subunit | - |
| M2R49_RS21070 (M2R49_21055) | 4364841..4365467 | - | 627 | WP_042999104.1 | dimethylsulfoxide reductase subunit B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18341.95 Da Isoelectric Point: 8.4403
>T244140 WP_044327726.1 NZ_CP096905:c4362346-4361870 [Citrobacter amalonaticus]
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETKVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGVERYRLFFRYSLESKIIVIAWVNDEGSLRTYGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETKVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGVERYRLFFRYSLESKIIVIAWVNDEGSLRTYGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|