Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2408643..2409205 | Replicon | chromosome |
| Accession | NZ_CP096905 | ||
| Organism | Citrobacter amalonaticus strain RSHH22 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3S7DBL2 |
| Locus tag | M2R49_RS11540 | Protein ID | WP_043000694.1 |
| Coordinates | 2408643..2408921 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M2R49_RS11545 | Protein ID | WP_043000693.1 |
| Coordinates | 2408921..2409205 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2R49_RS11520 (M2R49_11505) | 2403768..2404199 | - | 432 | WP_043000697.1 | peroxiredoxin OsmC | - |
| M2R49_RS11525 (M2R49_11510) | 2404427..2404570 | + | 144 | WP_042319017.1 | stationary-phase-induced ribosome-associated protein | - |
| M2R49_RS11530 (M2R49_11515) | 2404742..2406439 | + | 1698 | WP_044257943.1 | malate dehydrogenase | - |
| M2R49_RS11535 (M2R49_11520) | 2406748..2408463 | + | 1716 | WP_054177019.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| M2R49_RS11540 (M2R49_11525) | 2408643..2408921 | + | 279 | WP_043000694.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2R49_RS11545 (M2R49_11530) | 2408921..2409205 | + | 285 | WP_043000693.1 | HigA family addiction module antitoxin | Antitoxin |
| M2R49_RS11550 (M2R49_11535) | 2409250..2409852 | - | 603 | WP_044257938.1 | inorganic diphosphatase | - |
| M2R49_RS11555 (M2R49_11540) | 2409979..2410635 | - | 657 | WP_043000691.1 | formate dehydrogenase-N subunit gamma | - |
| M2R49_RS11560 (M2R49_11545) | 2410628..2411512 | - | 885 | WP_043000690.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10573.12 Da Isoelectric Point: 8.9461
>T244130 WP_043000694.1 NZ_CP096905:2408643-2408921 [Citrobacter amalonaticus]
MIMNFRHKGLRDLFLHGKTSGVLAKHVKRLRHRLAVIDAAGCVNDINMPGYRLHPLSGDRDGVWSISVSGNWRMTFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLHGKTSGVLAKHVKRLRHRLAVIDAAGCVNDINMPGYRLHPLSGDRDGVWSISVSGNWRMTFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|