Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 66022..66286 Replicon plasmid pEC_RSHH22_1
Accession NZ_CP096903
Organism Escherichia coli strain RSHH22

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M1Y13_RS25300 Protein ID WP_001331364.1
Coordinates 66134..66286 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 66022..66079 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1Y13_RS25285 (61261) 61261..63552 - 2292 WP_129542156.1 F-type conjugative transfer protein TrbC -
M1Y13_RS25290 (63545) 63545..64615 - 1071 WP_052974687.1 IncI1-type conjugal transfer protein TrbB -
M1Y13_RS25295 (64634) 64634..65842 - 1209 WP_242386835.1 IncI1-type conjugal transfer protein TrbA -
- (66022) 66022..66079 - 58 NuclAT_0 - Antitoxin
- (66022) 66022..66079 - 58 NuclAT_0 - Antitoxin
- (66022) 66022..66079 - 58 NuclAT_0 - Antitoxin
- (66022) 66022..66079 - 58 NuclAT_0 - Antitoxin
M1Y13_RS25300 (66134) 66134..66286 + 153 WP_001331364.1 Hok/Gef family protein Toxin
M1Y13_RS25305 (66358) 66358..66609 - 252 WP_001291965.1 hypothetical protein -
M1Y13_RS25935 (67110) 67110..67205 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
M1Y13_RS25315 (67270) 67270..67446 - 177 WP_001054898.1 hypothetical protein -
M1Y13_RS25320 (67838) 67838..68047 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
M1Y13_RS25325 (68119) 68119..68601 - 483 WP_001672078.1 plasmid IncI1-type surface exclusion protein ExcA -
M1Y13_RS25330 (68842) 68842..71010 - 2169 WP_129542158.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..161535 161535


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T244123 WP_001331364.1 NZ_CP096903:66134-66286 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT244123 NZ_CP096903:c66079-66022 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References