Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4889964..4890566 | Replicon | chromosome |
Accession | NZ_CP096902 | ||
Organism | Escherichia coli strain RSHH22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M1Y13_RS23950 | Protein ID | WP_000897305.1 |
Coordinates | 4890255..4890566 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M1Y13_RS23945 | Protein ID | WP_000356397.1 |
Coordinates | 4889964..4890254 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1Y13_RS23920 (4885890) | 4885890..4886792 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M1Y13_RS23925 (4886789) | 4886789..4887424 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M1Y13_RS23930 (4887421) | 4887421..4888350 | + | 930 | WP_000027706.1 | formate dehydrogenase accessory protein FdhE | - |
M1Y13_RS23935 (4888680) | 4888680..4888922 | - | 243 | WP_001087409.1 | protein YiiF | - |
M1Y13_RS23940 (4889141) | 4889141..4889359 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M1Y13_RS23945 (4889964) | 4889964..4890254 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M1Y13_RS23950 (4890255) | 4890255..4890566 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M1Y13_RS23955 (4890795) | 4890795..4891703 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
M1Y13_RS23960 (4891767) | 4891767..4892708 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M1Y13_RS23965 (4892753) | 4892753..4893190 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M1Y13_RS23970 (4893187) | 4893187..4894059 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M1Y13_RS23975 (4894053) | 4894053..4894652 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T244122 WP_000897305.1 NZ_CP096902:c4890566-4890255 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|