Detailed information of TA system TA244104

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ralRA/-
• Location: 2147993..2148364
• Replicon: chromosome
• Accession: NZ_CP096902
• Organism: Escherichia coli strain RSHH22

Toxin (Protein)

• Gene name: ralR
• Uniprot ID: -
• Locus tag: M1Y13_RS10570
• Protein ID: WP_129542092.1
• Coordinates: 2148170..2148364 (-)
• Length: 65 a.a.

Antitoxin (RNA)

Gene name	ralA
Locus tag	-
Coordinates	2147993..2148171 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M1Y13_RS10530 (2143435)	2143435..2144091	-	657	WP_242386750.1	carbon-nitrogen hydrolase family protein YobB	-
M1Y13_RS10535 (2144193)	2144193..2144423	-	231	WP_000916763.1	DNA polymerase III subunit theta	-
M1Y13_RS10540 (2144562)	2144562..2144936	+	375	WP_000204699.1	CopC domain-containing protein YobA	-
M1Y13_RS10545 (2144940)	2144940..2145812	+	873	WP_000879280.1	copper homeostasis membrane protein CopD	-
M1Y13_RS10550 (2145825)	2145825..2146166	+	342	WP_000976492.1	YebY family protein	-
M1Y13_RS10555 (2146559)	2146559..2147635	-	1077	WP_001189091.1	phage integrase Arm DNA-binding domain-containing protein	-
M1Y13_RS10560 (2147601)	2147601..2147882	-	282	WP_001311878.1	excisionase	-
- (2147993)	2147993..2148171	+	179	NuclAT_0	-	Antitoxin
- (2147993)	2147993..2148171	+	179	NuclAT_0	-	Antitoxin
- (2147993)	2147993..2148171	+	179	NuclAT_0	-	Antitoxin
- (2147993)	2147993..2148171	+	179	NuclAT_0	-	Antitoxin
M1Y13_RS10565 (2147989)	2147989..2148177	-	189	WP_001356607.1	DUF1187 family protein	-
M1Y13_RS10570 (2148170)	2148170..2148364	-	195	WP_129542092.1	type I toxin-antitoxin system endodeoxyribonuclease toxin RalR	Toxin
M1Y13_RS10575 (2148397)	2148397..2149077	-	681	WP_129541926.1	YqaJ viral recombinase family protein	-
M1Y13_RS10580 (2149074)	2149074..2149859	-	786	WP_063119826.1	phage recombination protein Bet	-
M1Y13_RS10585 (2149865)	2149865..2150161	-	297	WP_129542093.1	host-nuclease inhibitor Gam family protein	-
M1Y13_RS10590 (2150319)	2150319..2152157	-	1839	Protein_2072	hypothetical protein	-
M1Y13_RS10595 (2152256)	2152256..2152531	-	276	WP_001452559.1	hypothetical protein	-
M1Y13_RS10600 (2152606)	2152606..2152776	-	171	WP_001359121.1	YdaE family protein	-
M1Y13_RS10605 (2152776)	2152776..2152997	-	222	WP_129541924.1	cell division protein FtsZ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2124175..2211247	87072

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Endodeoxyribonuclease toxin RalR (6-54)

Sequences

Toxin

Protein

• Length: 65 a.a.
• Molecular weight: 7031.95 Da
• Isoelectric Point: 8.9493

>T244104 WP_129542092.1 NZ_CP096902:c2148364-2148170 [Escherichia coli]
VLYTKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTDYSGSEKEALERWNKRTTGNNNGGVHV

Nucleotide

• Length: 195 bp

Antitoxin

Nucleotide

• Length: 179 bp

>AT244104 NZ_CP096902:2147993-2148171 [Escherichia coli]
GAGGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCAGTAATTTT

Structures

Antitoxin