Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1276815..1277335 | Replicon | chromosome |
Accession | NZ_CP096882 | ||
Organism | Pseudarthrobacter sp. SSS035 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | MUN23_RS05765 | Protein ID | WP_248762949.1 |
Coordinates | 1277063..1277335 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | MUN23_RS05760 | Protein ID | WP_248762947.1 |
Coordinates | 1276815..1277066 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUN23_RS05735 | 1273175..1274092 | + | 918 | WP_248762939.1 | oxygenase MpaB family protein | - |
MUN23_RS05745 | 1274582..1274908 | + | 327 | WP_248762941.1 | hypothetical protein | - |
MUN23_RS05750 | 1275309..1276202 | - | 894 | WP_248762943.1 | GIY-YIG nuclease family protein | - |
MUN23_RS05755 | 1276436..1276690 | - | 255 | WP_248762945.1 | hypothetical protein | - |
MUN23_RS05760 | 1276815..1277066 | + | 252 | WP_248762947.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
MUN23_RS05765 | 1277063..1277335 | + | 273 | WP_248762949.1 | Txe/YoeB family addiction module toxin | Toxin |
MUN23_RS05775 | 1277562..1280981 | + | 3420 | WP_248762955.1 | DNA polymerase III subunit gamma and tau | - |
MUN23_RS05780 | 1281045..1281644 | + | 600 | WP_056348564.1 | recombination mediator RecR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10779.12 Da Isoelectric Point: 8.8479
>T244081 WP_248762949.1 NZ_CP096882:1277063-1277335 [Pseudarthrobacter sp. SSS035]
MKHSWDESAWEDYLWWQAQDRRTMKRIKTLIQDIARNGNEGIGKPEPLKHGFHGYWSRRITDEHRLVYRYVESGSGVEIL
IAACRYHYGN
MKHSWDESAWEDYLWWQAQDRRTMKRIKTLIQDIARNGNEGIGKPEPLKHGFHGYWSRRITDEHRLVYRYVESGSGVEIL
IAACRYHYGN
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|