Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3497412..3498082 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | M1775_RS16505 | Protein ID | WP_003899954.1 |
Coordinates | 3497412..3497756 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | M1775_RS16510 | Protein ID | WP_003899955.1 |
Coordinates | 3497753..3498082 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS16470 (M1775_16465) | 3492485..3493345 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
M1775_RS16475 (M1775_16470) | 3493320..3493835 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
M1775_RS16480 (M1775_16475) | 3493851..3494062 | + | 212 | Protein_3253 | (R)-hydratase | - |
M1775_RS16485 (M1775_16480) | 3494075..3494368 | + | 294 | WP_003416635.1 | hypothetical protein | - |
M1775_RS16490 (M1775_16485) | 3494656..3495945 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
M1775_RS16495 (M1775_16490) | 3496292..3496726 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
M1775_RS16500 (M1775_16495) | 3496729..3497181 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M1775_RS16505 (M1775_16500) | 3497412..3497756 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M1775_RS16510 (M1775_16505) | 3497753..3498082 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
M1775_RS16515 (M1775_16510) | 3498620..3498967 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
M1775_RS16520 (M1775_16515) | 3498964..3499584 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
M1775_RS16525 (M1775_16520) | 3499744..3501009 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
M1775_RS16530 (M1775_16525) | 3501177..3501386 | + | 210 | WP_003416778.1 | hypothetical protein | - |
M1775_RS16535 (M1775_16530) | 3501633..3502667 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T243957 WP_003899954.1 NZ_CP096846:3497412-3497756 [Mycobacterium tuberculosis variant bovis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT243957 WP_003899955.1 NZ_CP096846:3497753-3498082 [Mycobacterium tuberculosis variant bovis]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0THF6 |