Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2188883..2189751 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | M1775_RS10190 | Protein ID | WP_010886136.1 |
| Coordinates | 2188883..2189260 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | M1775_RS10195 | Protein ID | WP_003409886.1 |
| Coordinates | 2189302..2189751 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS10140 (M1775_10145) | 2184672..2185124 | - | 453 | WP_010950636.1 | lipoprotein | - |
| M1775_RS10145 (M1775_10150) | 2185188..2185589 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| M1775_RS10150 (M1775_10155) | 2185582..2185764 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| M1775_RS10155 (M1775_10160) | 2185878..2186228 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| M1775_RS10160 (M1775_10165) | 2186239..2187141 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| M1775_RS10165 (M1775_10170) | 2187162..2187353 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| M1775_RS10170 (M1775_10175) | 2187354..2187650 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| M1775_RS10175 (M1775_10180) | 2187890..2188105 | + | 216 | WP_003409878.1 | antitoxin | - |
| M1775_RS10180 (M1775_10185) | 2188102..2188413 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| M1775_RS10185 (M1775_10190) | 2188387..2188908 | - | 522 | WP_010950637.1 | hypothetical protein | - |
| M1775_RS10190 (M1775_10195) | 2188883..2189260 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| M1775_RS10195 (M1775_10200) | 2189302..2189751 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| M1775_RS10200 (M1775_10205) | 2189748..2190293 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| M1775_RS10205 (M1775_10210) | 2190182..2190796 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| M1775_RS10210 (M1775_10215) | 2190845..2191141 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M1775_RS10215 (M1775_10220) | 2191138..2191389 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| M1775_RS10220 (M1775_10225) | 2191376..2191870 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| M1775_RS10225 (M1775_10230) | 2192030..2192437 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| M1775_RS10230 (M1775_10235) | 2192441..2192713 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| M1775_RS10235 (M1775_10240) | 2192746..2193966 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T243934 WP_010886136.1 NZ_CP096846:2188883-2189260 [Mycobacterium tuberculosis variant bovis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT243934 WP_003409886.1 NZ_CP096846:2189302-2189751 [Mycobacterium tuberculosis variant bovis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|