Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 40114..40384 | Replicon | plasmid pO111_3 |
Accession | NC_013366 | ||
Organism | Escherichia coli O111:H- str. 11128 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | ECO111_RS29880 | Protein ID | WP_001312861.1 |
Coordinates | 40226..40384 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 40114..40177 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECO111_RS34005 | 35133..35435 | + | 303 | WP_077625669.1 | hypothetical protein | - |
ECO111_RS29850 | 35908..36435 | + | 528 | WP_000290792.1 | single-stranded DNA-binding protein | - |
ECO111_RS29855 | 36491..36724 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
ECO111_RS29860 | 36783..38741 | + | 1959 | WP_001145472.1 | ParB/RepB/Spo0J family partition protein | - |
ECO111_RS29865 | 38796..39230 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
ECO111_RS29870 | 39227..39946 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
ECO111_RS34110 | 39958..40146 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 39958..40182 | + | 225 | NuclAT_0 | - | - |
- | 39958..40182 | + | 225 | NuclAT_0 | - | - |
- | 39958..40182 | + | 225 | NuclAT_0 | - | - |
- | 39958..40182 | + | 225 | NuclAT_0 | - | - |
- | 40114..40177 | - | 64 | - | - | Antitoxin |
ECO111_RS29880 | 40226..40384 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ECO111_RS34195 | 40738..40962 | - | 225 | WP_001427866.1 | hypothetical protein | - |
ECO111_RS29895 | 41306..41593 | + | 288 | WP_000107535.1 | hypothetical protein | - |
ECO111_RS29900 | 41714..42535 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
ECO111_RS29905 | 42832..43341 | - | 510 | Protein_51 | transglycosylase SLT domain-containing protein | - |
ECO111_RS29910 | 43755..44138 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
ECO111_RS29915 | 44325..45014 | + | 690 | WP_000283394.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hlyC / hlyA / hlyB / hlyD / espP | 1..77690 | 77690 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T24370 WP_001312861.1 NC_013366:40226-40384 [Escherichia coli O111:H- str. 11128]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T24370 NC_013366:40226-40384 [Escherichia coli O111:H- str. 11128]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT24370 NC_013366:c40177-40114 [Escherichia coli O111:H- str. 11128]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|