Detailed information of TA system TA243198

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2715669..2715889
• Replicon: chromosome
• Accession: NZ_CP096587
• Organism: Escherichia coli strain EC6622

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: M1B75_RS13370
• Protein ID: WP_000170965.1
• Coordinates: 2715782..2715889 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2715669..2715735 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M1B75_RS13345	2710948..2712342	-	1395	WP_000086201.1	inverse autotransporter invasin YchO	-
M1B75_RS13350	2712527..2712880	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
M1B75_RS13355	2712924..2713619	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
M1B75_RS13360	2713777..2714007	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
M1B75_RS13365	2714277..2715377	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2715669..2715735	-	67	-	-	Antitoxin
M1B75_RS13370	2715782..2715889	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2716202..2716267	-	66	NuclAT_28	-	-
-	2716202..2716267	-	66	NuclAT_28	-	-
-	2716202..2716267	-	66	NuclAT_28	-	-
-	2716202..2716267	-	66	NuclAT_28	-	-
-	2716202..2716267	-	66	NuclAT_30	-	-
-	2716202..2716267	-	66	NuclAT_30	-	-
-	2716202..2716267	-	66	NuclAT_30	-	-
-	2716202..2716267	-	66	NuclAT_30	-	-
-	2716202..2716267	-	66	NuclAT_32	-	-
-	2716202..2716267	-	66	NuclAT_32	-	-
-	2716202..2716267	-	66	NuclAT_32	-	-
-	2716202..2716267	-	66	NuclAT_32	-	-
-	2716202..2716267	-	66	NuclAT_34	-	-
-	2716202..2716267	-	66	NuclAT_34	-	-
-	2716202..2716267	-	66	NuclAT_34	-	-
-	2716202..2716267	-	66	NuclAT_34	-	-
-	2716202..2716267	-	66	NuclAT_36	-	-
-	2716202..2716267	-	66	NuclAT_36	-	-
-	2716202..2716267	-	66	NuclAT_36	-	-
-	2716202..2716267	-	66	NuclAT_36	-	-
-	2716202..2716267	-	66	NuclAT_38	-	-
-	2716202..2716267	-	66	NuclAT_38	-	-
-	2716202..2716267	-	66	NuclAT_38	-	-
-	2716202..2716267	-	66	NuclAT_38	-	-
-	2716203..2716269	-	67	NuclAT_39	-	-
-	2716203..2716269	-	67	NuclAT_39	-	-
-	2716203..2716269	-	67	NuclAT_39	-	-
-	2716203..2716269	-	67	NuclAT_39	-	-
-	2716203..2716269	-	67	NuclAT_41	-	-
-	2716203..2716269	-	67	NuclAT_41	-	-
-	2716203..2716269	-	67	NuclAT_41	-	-
-	2716203..2716269	-	67	NuclAT_41	-	-
-	2716204..2716267	-	64	NuclAT_16	-	-
-	2716204..2716267	-	64	NuclAT_16	-	-
-	2716204..2716267	-	64	NuclAT_16	-	-
-	2716204..2716267	-	64	NuclAT_16	-	-
-	2716204..2716267	-	64	NuclAT_18	-	-
-	2716204..2716267	-	64	NuclAT_18	-	-
-	2716204..2716267	-	64	NuclAT_18	-	-
-	2716204..2716267	-	64	NuclAT_18	-	-
-	2716204..2716267	-	64	NuclAT_20	-	-
-	2716204..2716267	-	64	NuclAT_20	-	-
-	2716204..2716267	-	64	NuclAT_20	-	-
-	2716204..2716267	-	64	NuclAT_20	-	-
-	2716204..2716267	-	64	NuclAT_22	-	-
-	2716204..2716267	-	64	NuclAT_22	-	-
-	2716204..2716267	-	64	NuclAT_22	-	-
-	2716204..2716267	-	64	NuclAT_22	-	-
-	2716204..2716267	-	64	NuclAT_24	-	-
-	2716204..2716267	-	64	NuclAT_24	-	-
-	2716204..2716267	-	64	NuclAT_24	-	-
-	2716204..2716267	-	64	NuclAT_24	-	-
-	2716204..2716267	-	64	NuclAT_26	-	-
-	2716204..2716267	-	64	NuclAT_26	-	-
-	2716204..2716267	-	64	NuclAT_26	-	-
-	2716204..2716267	-	64	NuclAT_26	-	-
M1B75_RS13375	2716317..2716424	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
M1B75_RS13380	2716573..2717427	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
M1B75_RS13385	2717463..2718272	-	810	WP_001257044.1	invasion regulator SirB1	-
M1B75_RS13390	2718276..2718668	-	393	WP_000200392.1	invasion regulator SirB2	-
M1B75_RS13395	2718665..2719498	-	834	WP_000456467.1	peptide chain release factor N(5)-glutamine methyltransferase	-
M1B75_RS13400	2719498..2720580	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T243198 WP_000170965.1 NZ_CP096587:2715782-2715889 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T243198 NZ_OW970422:c4648357-4647824 [Klebsiella pneumoniae]
ATGGAGCAGCAACTGACGATTGAGATGATTGCCGATGCGTTCAGCTACGATATCACTGGATTTGATTGCGGCGAGGAAGC
GCTGAATACGTTTTTAAAAGAGCACCTCAAGCGGCAGCACGATGGACAAATCTTAAGGGGTTATGCGCTGGTCTCCGGGG
ATACCGTTCCCAGGTTGCTGGGTTATTACACCTTATCGGGGAGTTGTTTCGAGCGAGGCATGTTGCCGTCTAAAACTCAG
CAAAAGAAAATCCCGTATCAAAATGCGCCAAGCGTAACCCTCGGGCGGCTGGCCATTGATAAATCTGTTCAGGGGCAGGG
CTGGGGAGAGATGTTGGTTGCCCATGTGATGCGAGTGGTGTGGGGAGCGTCTAAAGCCGTTGGCATCTACGGATTGTTTG
TTGAAGCCCTTAATGAGAAAGCTAAAGCATTCTATCTTCGTCTGGGGTTTATACAGCTCGTGGATGAAAATAGTAACTTA
CTGTTTTATCCGACCAAATCGATTGAACAGCTCTTTACTGACGATGAGTCATAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT243198 NZ_CP096587:c2715735-2715669 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin